Mouse Anti-NANP Antibody (CBMOAB-52221FYA)


Cat: CBMOAB-52221FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52221FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO52221FYA 100 µg
CBMOAB-88337FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO88337FYA 100 µg
MO-AB-05465H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05465C 100 µg
MO-AB-16370R Monoclonal Cattle (Bos taurus) WB, ELISA MO16370R 100 µg
MO-AB-17965W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17965W 100 µg
MO-AB-27382H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27382C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO52221FYA
SpecificityThis antibody binds to Rhesus NANP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus NANP Antibody is a mouse antibody against NANP. It can be used for NANP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesN-acylneuraminate-9-phosphatase; NANP
UniProt IDH9F762
Protein RefseqThe length of the protein is 246 amino acids long.
The sequence is show below: LSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNICITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYIVSSVLELPALLQSIDRKVSMST.
For Research Use Only | Not For Clinical Use.
Online Inquiry