AibGenesis™ Mouse Anti-NCBP2 Antibody (CBMOAB-00111HCB)
Cat: CBMOAB-00111HCB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-00111HCB | Monoclonal | C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO00111HB | 100 µg | ||
| CBMOAB-88458FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO88458FYA | 100 µg | ||
| MO-AB-03054Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03054Y | 100 µg | ||
| MO-AB-04603W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO04603W | 100 µg | ||
| MO-AB-16421R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16421R | 100 µg | ||
| MO-AB-23754W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23754W | 100 µg | ||
| MO-AB-27397H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27397C | 100 µg | ||
| MO-AB-59785W | Monoclonal | Marmoset | WB, ELISA | MO59785W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO00111HB |
| Specificity | This antibody binds to C. elegans NCBP2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein has an RNP domain commonly found in RNA binding proteins, and contains the cap-binding activity. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. Multiple transcript variants encoding different isoforms have been found for this gene. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-C. elegans NCBP2 Antibody is a mouse antibody against NCBP2. It can be used for NCBP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Nuclear cap-binding protein subunit 2; 20 kDa nuclear cap-binding protein; NCBP 20 kDa subunit; CBP20; ncbp-2 |
| UniProt ID | Q93594 |
| Protein Refseq | The length of the protein is 158 amino acids long. The sequence is show below: MVFDPRTLDNPKEISAYRDQRYQGTVRDQETALRTSCTLYVGNLSYYTKEDQVYELFGRAGDVRRVIMGLDRFKKTPCGFCFVEYYTREDAELALQNISNTRMDDRVIRADWDAGFIEGRQYGRGKHGGQVRDEYRKDYDPERGGYNRAIAQKGGDRQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry