AibGenesis™ Mouse Anti-NDUFA4L2 Antibody (CBMOAB-52381FYA)


Cat: CBMOAB-52381FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52381FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO52381FYA 100 µg
MO-AB-16587R Monoclonal Cattle (Bos taurus) WB, ELISA MO16587R 100 µg
MO-AB-27420H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27420C 100 µg
MO-AB-59861W Monoclonal Marmoset WB, ELISA MO59861W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO52381FYA
SpecificityThis antibody binds to Rhesus NDUFA4L2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus NDUFA4L2 Antibody is a mouse antibody against NDUFA4L2. It can be used for NDUFA4L2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2; NDUFA4L2
UniProt IDH9F445
Protein RefseqThe length of the protein is 86 amino acids long.
The sequence is show below: AGASLGARFYQQIKRHPGIIPMIGFICLGMGSAGLYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF.
For Research Use Only | Not For Clinical Use.
Online Inquiry