Mouse Anti-NDUFA4L2 Antibody (CBMOAB-52381FYA)
Cat: CBMOAB-52381FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-52381FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO52381FYA | 100 µg | ||
| MO-AB-16587R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16587R | 100 µg | ||
| MO-AB-27420H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27420C | 100 µg | ||
| MO-AB-59861W | Monoclonal | Marmoset | WB, ELISA | MO59861W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO52381FYA |
| Specificity | This antibody binds to Rhesus NDUFA4L2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | NDUFA4L2 (NDUFA4, Mitochondrial Complex Associated Like 2) is a Protein Coding gene. Among its related pathways are GABAergic synapse and Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.. An important paralog of this gene is NDUFA4. |
| Product Overview | Mouse Anti-Rhesus NDUFA4L2 Antibody is a mouse antibody against NDUFA4L2. It can be used for NDUFA4L2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2; NDUFA4L2 |
| UniProt ID | H9F445 |
| Protein Refseq | The length of the protein is 86 amino acids long. The sequence is show below: AGASLGARFYQQIKRHPGIIPMIGFICLGMGSAGLYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry