Mouse Anti-NDUFB2 Antibody (CBMOAB-52399FYA)


Cat: CBMOAB-52399FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52399FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO52399FYA 100 µg
MO-AB-05523H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05523C 100 µg
MO-AB-16608R Monoclonal Cattle (Bos taurus) WB, ELISA MO16608R 100 µg
MO-AB-23209W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23209W 100 µg
MO-AB-27431H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27431C 100 µg
MO-AB-59877W Monoclonal Marmoset WB, ELISA MO59877W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO52399FYA
SpecificityThis antibody binds to Rhesus NDUFB2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays a important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Hydropathy analysis revealed that this subunit and 4 other subunits have an overall hydrophilic pattern, even though they are found within the hydrophobic protein (HP) fraction of complex I.
Product OverviewMouse Anti-Rhesus NDUFB2 Antibody is a mouse antibody against NDUFB2. It can be used for NDUFB2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNDUFB2
UniProt IDF6QFW1
Protein RefseqThe length of the protein is 95 amino acids long.
The sequence is show below: MESHERRPLVLREEIGGCCSSLSASGGVHIEPRYRQFPQLTRSQVFQGELYSGFMWFWILWRFWHDSEDVLGHFPYPDPSQWTDEELGIPPDNED.
For Research Use Only | Not For Clinical Use.
Online Inquiry