Mouse Anti-NDUFB8 Antibody (CBMOAB-52402FYA)


Cat: CBMOAB-52402FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52402FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO52402FYA 100 µg
CBMOAB-88647FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO88647FYA 100 µg
MO-AB-05529H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05529C 100 µg
MO-AB-16614R Monoclonal Cattle (Bos taurus) WB, ELISA MO16614R 100 µg
MO-AB-17132W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17132W 100 µg
MO-AB-27438H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27438C 100 µg
MO-AB-27715R Monoclonal Pig (Sus scrofa) WB, ELISA MO27715R 100 µg
MO-AB-37861W Monoclonal Goat (Capra hircus) WB, ELISA MO37861W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO52402FYA
SpecificityThis antibody binds to Rhesus NDUFB8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAccessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Product OverviewMouse Anti-Rhesus NDUFB8 Antibody is a mouse antibody against NDUFB8. It can be used for NDUFB8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial; NDUFB8
UniProt IDH9F2F5
Protein RefseqThe length of the protein is 174 amino acids long.
The sequence is show below: WLQRASRNVVPLGARTASRMTKDMLPGPYPRTPEERAAAAKKYNMLVEDYEPYPDEGMGYGDYPKLPDRSQHERDPWYSWDQPDLRLNWGEPMHWHIDMYTRNRVDTSPTPVSWNVMCMHLFGFLAFMTFMFWVGDVYPSYQPVGPKQYPYNNLYLERGGDPSKEPELVVHYEI.
For Research Use Only | Not For Clinical Use.
Online Inquiry