Mouse Anti-Nile tilapia fshb Antibody (MO-AB-33118H)


Cat: MO-AB-33118H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityNile tilapia (Oreochromis niloticus)
CloneMO33118C
SpecificityThis antibody binds to Nile tilapia fshb.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein.
Product OverviewThis product is a mouse antibody against fshb. It can be used for fshb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFSH beta subunit; LOC100534500
UniProt IDQ7T2Y6
Protein RefseqThe length of the protein is 113 amino acids long.
The sequence is show below: MQLVVMAAVLALAGAEQDCSSGCRPKNISLPVDTCGFVDTTICEGQCFQKDPNFIHTDDWPKQKTCNGEWSYEVKYTEQCPRGFIYPVARKCECTACNANTDCGTLSGYIPSC.
For Research Use Only | Not For Clinical Use.
Online Inquiry