Mouse Anti-NMNAT3 Antibody (CBMOAB-52776FYA)


Cat: CBMOAB-52776FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52776FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO52776FYA 100 µg
MO-AB-04751W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04751W 100 µg
MO-AB-27513H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27513C 100 µg
MO-AB-60144W Monoclonal Marmoset WB, ELISA MO60144W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus)
CloneMO52776FYA
SpecificityThis antibody binds to Rhesus NMNAT3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the nicotinamide/nicotinic acid mononucleotide adenylyltransferase family. These enzymes use ATP to catalyze the synthesis of nicotinamide adenine dinucleotide or nicotinic acid adenine dinucleotide from nicotinamide mononucleotide or nicotinic acid mononucleotide, respectively. The encoded protein is localized to mitochondria and may also play a neuroprotective role as a molecular chaperone. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product OverviewMouse Anti-Rhesus NMNAT3 Antibody is a mouse antibody against NMNAT3. It can be used for NMNAT3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNMNAT3
UniProt IDF6X0R2
Protein RefseqThe length of the protein is 215 amino acids long.
The sequence is show below: MYQVIQGIISPVNDNYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQTQWMETVKVLRHHHSELLRSPPQMEGPDHGKALSPTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRAGHDPKGYISESPILRMHQHNIHLAKEPVQNEISATHVRRALGQGQSVKYLIPDAVITYIKDHGLYTKDSAWKGKSTQSAEGKTS.
For Research Use Only | Not For Clinical Use.
Online Inquiry