Mouse Anti-NOS1 Antibody (CBMOAB-07642HCB)


Cat: CBMOAB-07642HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07642HCB Monoclonal C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Elephant (Loxodonta africana), Frog (Xenopus laevis), Grape (Vitis vinifera), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Rice (Oryza), Sea-anemone, Sheep (Ovis aries), Tomato (Lycopersicon esculentum), Zebrafish (Danio rerio) WB, ELISA MO07642HB 100 µg
CBMOAB-35004FYB Monoclonal Rice (Oryza) WB, ELISA MO35004FYB 100 µg
CBMOAB-89627FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO89627FYA 100 µg
MO-AB-00904L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00904L 100 µg
MO-AB-01067R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01067R 100 µg
MO-AB-04758W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04758W 100 µg
MO-AB-05706H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05706C 100 µg
MO-AB-08968Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08968Y 100 µg
MO-AB-13942Y Monoclonal Sea-anemone WB, ELISA MO13942Y 100 µg
MO-AB-16342Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16342Y 100 µg
MO-AB-16850R Monoclonal Cattle (Bos taurus) WB, ELISA MO16850R 100 µg
MO-AB-23535H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23535C 100 µg
MO-AB-27530H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27530C 100 µg
MO-AB-27800R Monoclonal Pig (Sus scrofa) WB, ELISA MO27800R 100 µg
MO-AB-33495H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO33495C 100 µg
MO-AB-34967H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34967C 100 µg
MO-AB-39322W Monoclonal Grape (Vitis vinifera) WB, ELISA MO39322W 100 µg
MO-AB-42149W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42149W 100 µg
MO-AB-45800W Monoclonal Horse (Equus caballus) WB, ELISA MO45800W 100 µg
MO-AB-60207W Monoclonal Marmoset WB, ELISA MO60207W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Elephant (Loxodonta africana), Frog (Xenopus laevis), Grape (Vitis vinifera), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Rice (Oryza), Sea-anemone, Sheep (Ovis aries), Tomato (Lycopersicon esculentum), Zebrafish (Danio rerio)
CloneMO07642HB
SpecificityThis antibody binds to C. elegans NOS1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the family of nitric oxide synthases, which synthesize nitric oxide from L-arginine. Nitric oxide is a reactive free radical, which acts as a biologic mediator in several processes, including neurotransmission, and antimicrobial and antitumoral activities. In the brain and peripheral nervous system, nitric oxide displays many properties of a neurotransmitter, and has been implicated in neurotoxicity associated with stroke and neurodegenerative diseases, neural regulation of smooth muscle, including peristalsis, and penile erection. This protein is ubiquitously expressed, with high level of expression in skeletal muscle. Multiple transcript variants that differ in the 5' UTR have been described for this gene but the full-length nature of these transcripts is not known. Additionally, alternatively spliced transcript variants encoding different isoforms (some testis-specific) have been found for this gene.
Product OverviewMouse Anti-C. elegans NOS1 Antibody is a mouse antibody against NOS1. It can be used for NOS1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein NOS-1; nos-1
UniProt IDQ09597
Protein RefseqThe length of the protein is 311 amino acids long. The sequence is show below: MLIFRTSPMSRREKSLPIEPKYTKPQANGSSFPPIFTLEGSTPCKKTARKLIDPVVNSVDSLCYLARKIVKMQEEKKRQKSNSFLIDYLVGDNFITEFREQPAQASPAVDVEDPMVSLVLGCPFGAIGQERRMSQDFPFQRRSFDMVSNRTSTSESSSCSSTDNTYKNAGKFLSLQEYLEQNNLLPPSTMPFGENSGFHGYNPQMNVHNNSTRNGNVENREQRNNSTSPPRGNPPHPLCCCFCFGTASEFARLHTLPAPRKDDRGPWSDHCSKKRGRVVCPKLRSMVCGICGATGDNAHTTKHHLEAFGDD.
For Research Use Only | Not For Clinical Use.
Online Inquiry