Mouse Anti-Nsmce1 Antibody (CBMOAB-25813FYA)


Cat: CBMOAB-25813FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-25813FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO25813FYA 100 µg
MO-AB-22144W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22144W 100 µg
MO-AB-60372W Monoclonal Marmoset WB, ELISA MO60372W 100 µg
MO-AB-16971R Monoclonal Cattle (Bos taurus) WB, ELISA MO16971R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO25813FYA
SpecificityThis antibody binds to fruit fly Nsmce1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRING-type zinc finger-containing E3 ubiquitin ligase that assembles with melanoma antigen protein (MAGE) to catalyze the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate. Within MAGE-RING ubiquitin ligase complex, MAGE stimulates and specifies ubiquitin ligase activity likely through recruitment and/or stabilization of the E2 ubiquitin-conjugating enzyme at the E3:substrate complex. Involved in maintenance of genome integrity, DNA damage response and DNA repair. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Nsmce1 Antibody is a mouse antibody against Nsmce1. It can be used for Nsmce1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNon-structural maintenance of chromosomes element 1 homolog; Non-SMC element 1 homolog
UniProt IDQ9VMA0
Protein RefseqThe length of the protein is 235 amino acids long.
The sequence is show below: MELVKRGFLRACKNHSYLSFELIDDILAPLCANHKTTKPGSKEAIRALVAEINDTISDLGQLLVFIKYPVKAEEYLVYAKTDATPDSVANTGLTAEECQYFSKLLDKIASEEDCHIAWNDAYNDIVLQASSKPLKKSRMQELLQKWIQMGYFMEVTDRIYLGPRSLVELSFYLSSNHADNIKNCTLCKCLVLWDIRCGSCNIQYHRGCIQTYLQRRDICPSCGNLWTTPIRRSIG.
For Research Use Only | Not For Clinical Use.
Online Inquiry