Mouse Anti-NTF3 Antibody (CBMOAB-53076FYA)
Cat: CBMOAB-53076FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-53076FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Zebrafish (Danio rerio) | WB, ELISA | MO53076FYA | 100 µg | ||
CBMOAB-90180FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO90180FYA | 100 µg | ||
MO-AB-03231Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03231Y | 100 µg | ||
MO-AB-05800H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05800C | 100 µg | ||
MO-AB-09093W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09093W | 100 µg | ||
MO-AB-16991R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16991R | 100 µg | ||
MO-AB-23540H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23540C | 100 µg | ||
MO-AB-26380W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26380W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Zebrafish (Danio rerio) |
Clone | MO53076FYA |
Specificity | This antibody binds to Rhesus NTF3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the neurotrophin family, that controls survival and differentiation of mammalian neurons. This protein is closely related to both nerve growth factor and brain-derived neurotrophic factor. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NTF3-deficient mice generated by gene targeting display severe movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. |
Product Overview | Mouse Anti-Rhesus NTF3 Antibody is a mouse antibody against NTF3. It can be used for NTF3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Neurotrophin 3; NTF3 |
UniProt ID | Q8SPT8 |
Protein Refseq | The length of the protein is 139 amino acids long. The sequence is show below: MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGQPAKSEFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGNPVVANRTSRRKRY. |
For Research Use Only | Not For Clinical Use.
Online Inquiry