AibGenesis™ Mouse Anti-NTF3 Antibody (CBMOAB-53076FYA)


Cat: CBMOAB-53076FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53076FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Zebrafish (Danio rerio) WB, ELISA MO53076FYA 100 µg
CBMOAB-90180FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO90180FYA 100 µg
MO-AB-03231Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03231Y 100 µg
MO-AB-05800H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05800C 100 µg
MO-AB-09093W Monoclonal Cat (Felis catus) WB, ELISA MO09093W 100 µg
MO-AB-16991R Monoclonal Cattle (Bos taurus) WB, ELISA MO16991R 100 µg
MO-AB-23540H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23540C 100 µg
MO-AB-26380W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26380W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Zebrafish (Danio rerio)
CloneMO53076FYA
SpecificityThis antibody binds to Rhesus NTF3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the neurotrophin family, that controls survival and differentiation of mammalian neurons. This protein is closely related to both nerve growth factor and brain-derived neurotrophic factor. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NTF3-deficient mice generated by gene targeting display severe movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. (From NCBI)
Product OverviewMouse Anti-Rhesus NTF3 Antibody is a mouse antibody against NTF3. It can be used for NTF3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNeurotrophin 3; NTF3
UniProt IDQ8SPT8
Protein RefseqThe length of the protein is 139 amino acids long.
The sequence is show below: MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGQPAKSEFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGNPVVANRTSRRKRY.
For Research Use Only | Not For Clinical Use.
Online Inquiry