Mouse Anti-NXNL1 Antibody (CBMOAB-53233FYA)


Cat: CBMOAB-53233FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53233FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO53233FYA 100 µg
CBMOAB-90405FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO90405FYA 100 µg
MO-AB-27621H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27621C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO53233FYA
SpecificityThis antibody binds to Rhesus NXNL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRetinitis pigmentosa (RP) is a disease that leads to blindness by degeneration of cone photoreceptors. Rods produce factors required for cone viability. The protein encoded by this gene is one of those factors and is similar to a truncated form of thioredoxin. This gene has been proposed to have therapeutic value against RP.
Product OverviewMouse Anti-Rhesus NXNL1 Antibody is a mouse antibody against NXNL1. It can be used for NXNL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNXNL1
UniProt IDF7CDB1
Protein RefseqThe length of the protein is 212 amino acids long.
The sequence is show below: MASLFSGRILICNNNDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDELRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTSCFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRRKYRVEKAARGGRDPGGGGGEEGGAGGLF.
For Research Use Only | Not For Clinical Use.
Online Inquiry