Mouse Anti-O. anatinus BDNF Antibody (MO-AB-06335Y)


Cat: MO-AB-06335Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityO. anatinus (Ornithorhynchus anatinus)
CloneMO06335Y
SpecificityThis antibody binds to O. anatinus BDNF.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDuring development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS.
Product OverviewThis product is a mouse antibody against BDNF. It can be used for BDNF detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesBrain-derived neurotrophic factor; BDNF
UniProt IDO02795
Protein RefseqThe length of the protein is 85 amino acids long. The sequence is show below: SISEWVTAADKKTAVDMSGGTVTVLEKVPVPKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDNKKRVG.
See other products for " BDNF "
MOFY-0722-FY210Rabbit Anti-BDNF Antibody (MOFY-0722-FY210)
MO-AB-22996HMouse Anti-Mallard BDNF Antibody (MO-AB-22996H)
MO-NAB-00428WRabbit Anti-BDNF Antibody (C-terminal)
MO-AB-08051RMouse Anti-Cattle BDNF Antibody (MO-AB-08051R)
MO-AB-10732YMouse Anti-O. mykiss BDNF Antibody (MO-AB-10732Y)
MO-AB-43848WMouse Anti-Horse BDNF Antibody (MO-AB-43848W)
CBMOAB-67619FYAMouse Anti-Zebrafish bdnf Antibody (CBMOAB-67619FYA)
MOFY-0622-FY209Rabbit Anti-BDNF Antibody (MOFY-0622-FY209)
CBMOAB-00274FYARabbit Anti-Mouse BDNF Antibody (CBMOAB-00274FYA)
MO-DKB-00681WRabbit Anti-BDNF Antibody (MO-DKB-00681W)
For Research Use Only | Not For Clinical Use.
Online Inquiry