Mouse Anti-O. mykiss ACBP Antibody (MO-AB-10598Y)
Cat: MO-AB-10598Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | O. mykiss (Oncorhynchus mykiss) |
Clone | MO10598Y |
Specificity | This antibody binds to O. mykiss ACBP. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | This product is a mouse antibody against ACBP. It can be used for ACBP detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Acyl-CoA-binding protein; ACBP |
UniProt ID | C1BHF1 |
Protein Refseq | The length of the protein is 87 amino acids long. The sequence is show below: MSEAEFDKAAEEVKQLKTKPADAEMLRVYALFKQAKVGDVNTARPGMLDFTGKAKWDAWEKEKGKNQGEARKEYIALVEELKGKYRV. |
See other products for " ACBP "
CBMOAB-18463FYB | Mouse Anti-Rice ACBP Antibody (CBMOAB-18463FYB) |
MO-AB-00013H | Mouse Anti-Arabidopsis ACBP Antibody (MO-AB-00013H) |
MO-AB-38809W | Mouse Anti-Grape ACBP Antibody (MO-AB-38809W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry