Mouse Anti-O. mykiss ACTB Antibody (MO-AB-10599Y)


Cat: MO-AB-10599Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityO. mykiss (Oncorhynchus mykiss)
CloneMO10599Y
SpecificityThis antibody binds to O. mykiss ACTB.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against ACTB. It can be used for ACTB detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesBeta-actin; ACTB
UniProt IDS5DU41
Protein RefseqThe length of the protein is 130 amino acids long. The sequence is show below: VLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG.
For Research Use Only | Not For Clinical Use.

Online Inquiry