Mouse Anti-O. mykiss AhR Antibody (MO-AB-10610Y)


Cat: MO-AB-10610Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityO. mykiss (Oncorhynchus mykiss)
CloneMO10610Y
SpecificityThis antibody binds to O. mykiss AhR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionLigand-activated transcriptional activator (PubMed:9022676). Binds to the XRE promoter region of genes it activates. Activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Involved in cell-cycle regulation. Likely to play an important role in the development and maturation of many tissues. Regulates the circadian clock by inhibiting the basal and circadian expression of the core circadian component PER1. Inhibits PER1 by repressing the CLOCK-ARNTL/BMAL1 heterodimer mediated transcriptional activation of PER1. The heterodimer ARNT:AHR binds to core DNA sequence 5''-TGCGTG-3'' within the dioxin response element (DRE) of target gene promoters and activates their transcription (By similarity).
Product OverviewThis product is a mouse antibody against AhR. It can be used for AhR detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesAryl hydrocarbon receptor; AhR
UniProt IDQ7ZTG8
Protein RefseqThe length of the protein is 56 amino acids long. The sequence is show below: LQPNNSSDITSNIVSYDPQHIPPENSSFLERSFVCRFRCLLDNSSGFLALNFNGRL.
For Research Use Only | Not For Clinical Use.
Online Inquiry