Mouse Anti-OR51V1 Antibody (MO-AB-00978L)


Cat: MO-AB-00978L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00978L Monoclonal Elephant (Loxodonta africana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Gorilla, Horse (Equus caballus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO00978L 100 µg
MO-AB-06680Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06680Y 100 µg
MO-AB-07668W Monoclonal Cat (Felis catus) WB, ELISA MO07668W 100 µg
MO-AB-09164Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09164Y 100 µg
MO-AB-16528Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16528Y 100 µg
MO-AB-17178W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17178W 100 µg
MO-AB-17270R Monoclonal Cattle (Bos taurus) WB, ELISA MO17270R 100 µg
MO-AB-32529W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32529W 100 µg
MO-AB-35291W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35291W 100 µg
MO-AB-38670W Monoclonal Gorilla WB, ELISA MO38670W 100 µg
MO-AB-45903W Monoclonal Horse (Equus caballus) WB, ELISA MO45903W 100 µg
MO-AB-60691W Monoclonal Marmoset WB, ELISA MO60691W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityElephant (Loxodonta africana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Gorilla, Horse (Equus caballus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO00978L
SpecificityThis antibody binds to Elephant OR51V1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Product OverviewThis product is a mouse antibody against OR51V1. It can be used for OR51V1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory Receptor Family 51 Subfamily V Member 1; Odorant Receptor HOR3beta1; Olfactory Receptor OR11-36; Olfactory Receptor 51A12; OR51A12; Olfactory Receptor, Family 51, Subfamily V, Member 1; Olfactory Receptor 51V1; OR11-36
UniProt IDG3UA05
Protein RefseqThe length of the protein is 314 amino acids long. The sequence is show below: MFAPLSPSTNTSFFLLTGFSGLEQQYPWLCIPFSSIYAMVLLGNCMVLHVIWTEPSLHQPMFYLLAILAFTDLCMGLSTVHTVLGILWGLIQEISLDSCIAQSYFIHGLSFMESSVLLAMAFDRYIAICNPLRYSSILTNSRIIKIGLTIIGRSFFFITPPIMRLKLFHYCHPHVLSHSFCLHQDLLRLACSDIQINSYYALMLVICTLLLDAVLILISYILILKSVLAIASQEERHKSFQTCISHICAVLVFYIPIISLTMVHRFGKHLSPIVSVLMGNIYILFPPLMNPIIYSVKTQQIRSRILRLFPLKRY.
For Research Use Only | Not For Clinical Use.
Online Inquiry