Mouse Anti-PER2 Antibody (CBMOAB-38551FYC)


Cat: CBMOAB-38551FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38551FYC Monoclonal A. thaliana (Arabidopsis thaliana), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish, Zebrafish (Danio rerio) WB, ELISA MO38551FC 100 µg
CBMOAB-54279FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO54279FYA 100 µg
CBMOAB-92214FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92214FYA 100 µg
MO-AB-03393Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03393Y 100 µg
MO-AB-06179H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06179C 100 µg
MO-AB-17050Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17050Y 100 µg
MO-AB-20833W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20833W 100 µg
MO-AB-23588H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23588C 100 µg
MO-AB-46006W Monoclonal Horse (Equus caballus) WB, ELISA MO46006W 100 µg
MO-AB-61303W Monoclonal Marmoset WB, ELISA MO61303W 100 µg
MOFAB-574W Monoclonal Zebrafish WB, IHC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish, Zebrafish (Danio rerio)
CloneMO38551FC
SpecificityThis antibody binds to Arabidopsis PER2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cell Wall; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene may increase the risk of getting certain cancers and have been linked to sleep disorders.
Product OverviewMouse Anti-Arabidopsis PER2 Antibody is a mouse antibody against PER2. It can be used for PER2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPeriod Circadian Regulator 2; Circadian Clock Protein PERIOD 2; Period Circadian Clock 2; HPER2; Period Circadian Protein Homolog 2; Period (Drosophila) Homolog 2; Period Homolog 2 (Drosophila)
UniProt IDQ67Z07
Protein RefseqThe length of the protein is 325 amino acids long. The sequence is show below: MAIKNILALVVLLSVVGVSVAIPQLLDLDYYRSKCPKAEEIVRGVTVQYVSRQKTLAAKLLRMHFHDCFVRGCDGSVLLKSAKNDAERDAVPNLTLKGYEVVDAAKTALERKCPNLISCADVLALVARDAVAVIGGPWWPVPLGRRDGRISKLNDALLNLPSPFADIKTLKKNFANKGLNAKDLVVLSGGHTIGISSCALVNSRLYNFTGKGDSDPSMNPSYVRELKRKCPPTDFRTSLNMDPGSALTFDTHYFKVVAQKKGLFTSDSTLLDDIETKNYVQTQAILPPVFSSFNKDFSDSMVKLGFVQILTGKNGEIRKRCAFPN.
For Research Use Only | Not For Clinical Use.
Online Inquiry