Mouse Anti-PES1 Antibody (CBMOAB-08303HCB)


Cat: CBMOAB-08303HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08303HCB Monoclonal C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Gorilla, Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries) WB, ELISA MO08303HB 100 µg
CBMOAB-54289FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO54289FYA 100 µg
MO-AB-01283R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01283R 100 µg
MO-AB-08463W Monoclonal Cat (Felis catus) WB, ELISA MO08463W 100 µg
MO-AB-09312Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09312Y 100 µg
MO-AB-12754Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO12754Y 100 µg
MO-AB-17051Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17051Y 100 µg
MO-AB-17707W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17707W 100 µg
MO-AB-17772R Monoclonal Cattle (Bos taurus) WB, ELISA MO17772R 100 µg
MO-AB-28211R Monoclonal Pig (Sus scrofa) WB, ELISA MO28211R 100 µg
MO-AB-32674W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32674W 100 µg
MO-AB-33588H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO33588C 100 µg
MO-AB-35395W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35395W 100 µg
MO-AB-38707W Monoclonal Gorilla WB, ELISA MO38707W 100 µg
MO-AB-42302W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42302W 100 µg
MO-AB-46007W Monoclonal Horse (Equus caballus) WB, ELISA MO46007W 100 µg
MO-AB-61308W Monoclonal Marmoset WB, ELISA MO61308W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Gorilla, Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries)
CloneMO08303HB
SpecificityThis antibody binds to C. elegans PES1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a nuclear protein that contains a breast cancer associated gene 1 (BRCA1) C-terminal interaction domain. The encoded protein interacts with BOP1 and WDR12 to form the PeBoW complex, which plays a critical role in cell proliferation via pre-rRNA processing and 60S ribosomal subunit maturation. Expression of this gene may play an important role in breast cancer proliferation and tumorigenicity. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Pseudogenes of this gene are located on the long arm of chromosome 4 and the short arm of chromosome 9. (From NCBI)
Product OverviewMouse Anti-C. elegans PES1 Antibody is a mouse antibody against PES1. It can be used for PES1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPES-1 protein; PES-1A protein; Protein PES-1, isoform a; pes-1
UniProt IDG5EGC9
Protein RefseqThe length of the protein is 264 amino acids long. The sequence is show below: MTSSIKSDAPQFLLDLDNCSSLPPTPPKTASPGNSKMKGFNISDLCLDLDSSTSSSCSVSPASSFHTRSESVGQQQSGRNSPVSSSTESPTKRPKYSYNALIAMAIQSSPFKSLRVSEIYKYISSNFSYYKNQKPLQWQNSVRHNLSLHKEFRKVRTLDGKGSYWAMTADLGTDVYISNNCGKLRRQKSKVAKFPPMQQHFPIPQLPTQNIHQLCMQNPQILATLLQNMYLQNMQNLQNIPMVPGFPIIPVPINPTSFHFPKSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry