Mouse Anti-Pig ACADVL Antibody (MO-AB-23471R)


Cat: MO-AB-23471R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO23471R
SpecificityThis antibody binds to Pig ACADVL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewThis product is a mouse antibody against ACADVL. It can be used for ACADVL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVery-long-chain acyl-CoA dehydrogenase, Fragment; ACADVL
UniProt IDO62681
Protein RefseqThe length of the protein is 34 amino acids long.
The sequence is show below: FGVIQEKLARMAMLQYVTESMAYMVSANMDQGST.
For Research Use Only | Not For Clinical Use.
Online Inquiry