Mouse Anti-Pig ACADVL Antibody (MO-AB-23471R)
Cat: MO-AB-23471R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO23471R |
Specificity | This antibody binds to Pig ACADVL. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Product Overview | This product is a mouse antibody against ACADVL. It can be used for ACADVL detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Very-long-chain acyl-CoA dehydrogenase, Fragment; ACADVL |
UniProt ID | O62681 |
Protein Refseq | The length of the protein is 34 amino acids long. The sequence is show below: FGVIQEKLARMAMLQYVTESMAYMVSANMDQGST. |
See other products for " acadvl "
CBMOAB-64573FYA | Mouse Anti-Zebrafish acadvl Antibody (CBMOAB-64573FYA) |
CBMOAB-34926FYA | Mouse Anti-Rhesus ACADVL Antibody (CBMOAB-34926FYA) |
MO-AB-50292W | Mouse Anti-Marmoset ACADVL Antibody (MO-AB-50292W) |
MO-AB-22057W | Mouse Anti-Chimpanzee ACADVL Antibody (MO-AB-22057W) |
MO-AB-06849R | Mouse Anti-Cattle ACADVL Antibody (MO-AB-06849R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry