Mouse Anti-Pig ACPP Antibody (MO-AB-23492R)
Cat: MO-AB-23492R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO23492R |
Specificity | This antibody binds to Pig ACPP. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland. An alternatively spliced transcript variant encoding a longer isoform has been found for this gene. This isoform contains a transmembrane domain and is localized in the plasma membrane-endosomal-lysosomal pathway. |
Product Overview | This product is a mouse antibody against ACPP. It can be used for ACPP detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Prostatic acid phosphatase, Fragment; ACPP |
UniProt ID | Q9GKJ9 |
Protein Refseq | The length of the protein is 36 amino acids long. The sequence is show below: MSAMTNLAGLFPPEGISIWNPNLLWQPIPVHTVPLS. |
See other products for " ACPP "
MO-AB-10098W | Mouse Anti-Chimpanzee ACPP Antibody (MO-AB-10098W) |
CBMOAB-0025YC | Mouse Anti-E. coli acpP Antibody (CBMOAB-0025YC) |
MO-AB-09581H | Mouse Anti-Malaria parasite acpP Antibody (MO-AB-09581H) |
MO-AB-06916R | Mouse Anti-Cattle ACPP Antibody (MO-AB-06916R) |
MO-AB-50350W | Mouse Anti-Marmoset ACPP Antibody (MO-AB-50350W) |
CBMOAB-34985FYA | Mouse Anti-Rhesus ACPP Antibody (CBMOAB-34985FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry