Mouse Anti-Pig ACTB Antibody (MO-AB-23508R)


Cat: MO-AB-23508R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO23508R
SpecificityThis antibody binds to Pig ACTB.
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActins are highly conserved proteins that are involved in various types of cell motility. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to four others. The protein encoded by this gene belongs to the actin family which is comprised of three main groups of actin isoforms, alpha, beta, and gamma. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. Defects in this gene have been associated with idiopathic dilated cardiomyopathy (IDC) and familial hypertrophic cardiomyopathy (FHC).
Product OverviewThis product is a mouse antibody against ACTB. It can be used for ACTB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBeta actin, Fragment; ACTB
UniProt IDQ00P29
Protein RefseqThe length of the protein is 37 amino acids long.
The sequence is show below: WHHTFYNELRVAPEEHPVVLTEAPLNPKANREKMTQI.
For Research Use Only | Not For Clinical Use.

Online Inquiry