Cat: MO-AB-23508R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Pig (Sus scrofa) |
| Clone | MO23508R |
| Specificity | This antibody binds to Pig ACTB. |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Actins are highly conserved proteins that are involved in various types of cell motility. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to four others. The protein encoded by this gene belongs to the actin family which is comprised of three main groups of actin isoforms, alpha, beta, and gamma. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. Defects in this gene have been associated with idiopathic dilated cardiomyopathy (IDC) and familial hypertrophic cardiomyopathy (FHC). |
| Product Overview | This product is a mouse antibody against ACTB. It can be used for ACTB detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Beta actin, Fragment; ACTB |
| UniProt ID | Q00P29 |
| Protein Refseq | The length of the protein is 37 amino acids long. The sequence is show below: WHHTFYNELRVAPEEHPVVLTEAPLNPKANREKMTQI. |
See other products for " ACTB "
| MO-AB-14074Y | Mouse Anti-Sheep ACTB Antibody (MO-AB-14074Y) |
| MO-AB-43566W | Mouse Anti-Horse ACTB Antibody (MO-AB-43566W) |
| MO-AB-36665W | Mouse Anti-Goat ACTB Antibody (MO-AB-36665W) |
| CBMOAB-35023FYA | Mouse Anti-Rhesus ACTB Antibody (CBMOAB-35023FYA) |
| CBMOAB-35022FYA | Mouse Anti-Rhesus ACTB Antibody (CBMOAB-35022FYA) |
| MO-AB-06941R | Mouse Anti-Cattle ACTB Antibody (MO-AB-06941R) |
| MO-AB-09926W | Mouse Anti-Chimpanzee ACTB Antibody (MO-AB-09926W) |
| CBMOAB-35024FYA | Mouse Anti-Rhesus ACTB Antibody (CBMOAB-35024FYA) |
| CBMOAB-35021FYA | Mouse Anti-Rhesus ACTB Antibody (CBMOAB-35021FYA) |
| MO-AB-14075Y | Mouse Anti-Sheep ACTB Antibody (MO-AB-14075Y) |
For Research Use Only | Not For Clinical Use.