Mouse Anti-Pig ADI1 Antibody (MO-AB-23559R)


Cat: MO-AB-23559R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO23559R
SpecificityThis antibody binds to Pig ADI1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. Related pseudogenes have been defined on chromosomes 8 and 20. Alternative splicing results in multiple transcript variants encoding different isoforms. Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene). Also down-regulates cell migration mediated by MMP14.
Product OverviewThis product is a mouse antibody against ADI1. It can be used for ADI1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (EC 1.13.11.54) (Acireductone dioxygenase; Fe(2+)-requiring); Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1; ADI1; MTCBP1
UniProt IDI3LEI8
Protein RefseqThe length of the protein is 179 amino acids long.
The sequence is show below: MVQAWYMDESADDPRLPHRTEPARPVGLDQLRRLGVLYWKLDADKYENDPELEKIRNERNYSWMDIITICRDKLPNYEEKIKTFYEEHLHLDDEIRYILDGSGYFDVRDQDDRWIRIFMEKGDLITLPAGIYHRFTLDEQNYVKAMRLFVGDPVWTPYNRPADHLEARGQYLRFLAQST.
For Research Use Only | Not For Clinical Use.
Online Inquiry