Mouse Anti-Pig ADRB2 Antibody (MO-AB-23591R)


Cat: MO-AB-23591R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO23591R
SpecificityThis antibody binds to Pig ADRB2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. This receptor-channel complex also contains a G protein, an adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase, PP2A. The assembly of the signaling complex provides a mechanism that ensures specific and rapid signaling by this G protein-coupled receptor. This gene is intronless. Different polymorphic forms, point mutations, and/or downregulation of this gene are associated with nocturnal asthma, obesity and type 2 diabetes.
Product OverviewThis product is a mouse antibody against ADRB2. It can be used for ADRB2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBeta-2 adrenergic receptor; ADRB2
UniProt IDA7BJW1
Protein RefseqThe length of the protein is 418 amino acids long.
The sequence is show below: MGQPGNRSVFLLAPNGSHAPDQDVPQERNEAWVVGMAIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWTFGSFWCEFWISIDVLCVTASIETLCVIAVDRYLAITSPFKYQCLLTKNKARVVILMVWVVSGLISFLPIKMHWYQATHREALNCYAEEACCDFFTNQPYAIASSIVSFYLPLVVMVFVYSRVFQVARRQLQKIDKSEGRFHAQNLSQAEQDGRSGPGHRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHGIHDNLIPKEVYILLNWVGYVNSAFNPLIYCRSPDFRMAFQELLCLHRSSLKAYGNGCSSNSNGRTDYTGEQSGCYLGEEKDSERLCEEPPGPEGCAHRQGTVPDDSTDSQGRNCSTNDSML.
See other products for " ADRB2 "
MO-AB-00019LMouse Anti-Elephant ADRB2 Antibody (MO-AB-00019L)
MO-AB-07082RMouse Anti-Cattle ADRB2 Antibody (MO-AB-07082R)
MO-AB-28856WMouse Anti-Dog ADRB2 Antibody (MO-AB-28856W)
MO-AB-01278HMouse Anti-Frog adrb2 Antibody (MO-AB-01278H)
MO-AB-42908WMouse Anti-Hamsters ADRB2 Antibody (MO-AB-42908W)
MOFY-1222-FY94Rabbit Anti-ADRB2 Antibody (MOFY-1222-FY94)
CBMOAB-35268FYAMouse Anti-Rhesus ADRB2 Antibody (CBMOAB-35268FYA)
MO-DKB-03644WRabbit Anti-ADRB2 (C-terminal, clone ms2109-052) Antibody (Cat MO-DKB-03644W)
MO-AB-08508WMouse Anti-Cat ADRB2 Antibody (MO-AB-08508W)
CBMOAB-00299FYARabbit Anti-Mouse ADRB2 Antibody (CBMOAB-00299FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry