Mouse Anti-Pig AHR Antibody (MO-AB-23646R)


Cat: MO-AB-23646R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO23646R
SpecificityThis antibody binds to Pig AHR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a ligand-activated helix-loop-helix transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Before ligand binding, the encoded protein is sequestered in the cytoplasm; upon ligand binding, this protein moves to the nucleus and stimulates transcription of target genes.
Product OverviewThis product is a mouse antibody against AHR. It can be used for AHR detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAryl hydrocarbon receptor; AHR
UniProt IDK9J4M2
Protein RefseqThe length of the protein is 848 amino acids long.
The sequence is show below: MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVSLKSSPADRNGVQDNCRTKFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCPDSGQRIDEASGLSQPAAYYNPDQLPPETSFMERCFVCRLRCLLDNSSGFLAMNFQGRLKYLHGQNKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPTGCDAKGKIVLGYTEAELCMRGTGYQFIHAADMLYCAEYHVRMIKTGESGMIVFRLLTKDNRWTWVQSNARLVYKNGRPDYIIATQRPLTDEEGKEHLRKRTLKLPFMFATGEAVLYEITSPFPPTVDPLPVRTKSGANGKDSATKSSLSKDSLNPSSLLSAMMQQDESVYLCPASSSTPFERNFLSESLNEYSSWQNSVAPMGSDNVLKHEQIGQSQEMNLTPSGDHAGLFPDSRNSDLYSIMKHLGIDFEDIKHMQQNEEFFRTDFPGEDDFRDIDLTDEILTYVEDSLNKSTFGGSGYQQSLALNSSCMVQEQLQLEQQQQQQQHHQKHIAVEQQQQLCQKMKHMQVNGMFANWSSNQPVPFGCPQQDLQQDLQQYNIFPDLPGTNQEFSYKSEIDTLPYTQNFIPCSQSVLPQHPKCPQLDFSIGNFEPALYPTTSSNLEDFVTCLQGAENQKPGLNPQSAMVTPQTCYGGAVSMYPCQPDSQHSHVAQMQYSPAMPGPQAFLNKFQSGGVLNETYPNELNSINNTQTTTHLHPSEARPFPDLTSSGFL.
For Research Use Only | Not For Clinical Use.
Online Inquiry