Mouse Anti-Pig AMH Antibody (MO-AB-23702R)


Cat: MO-AB-23702R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO23702R
SpecificityThis antibody binds to Pig AMH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate N- and C-terminal cleavage products that homodimerize and associate to form a biologically active noncovalent complex. This complex binds to the anti-Mullerian hormone receptor type 2 and causes the regression of Mullerian ducts in the male embryo that would otherwise differentiate into the uterus and fallopian tubes. This protein also plays a role in Leydig cell differentiation and function and follicular development in adult females. Mutations in this gene result in persistent Mullerian duct syndrome.
Product OverviewThis product is a mouse antibody against AMH. It can be used for AMH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAnti-Mullerian hormone, Fragment; AMH
UniProt IDO18761
Protein RefseqThe length of the protein is 45 amino acids long.
The sequence is show below: AVRHARWGPQDLANFGLCPPSLRQAALPLLQQLQAWLGEPRGQRL.
For Research Use Only | Not For Clinical Use.
Online Inquiry