Mouse Anti-Pig AMH Antibody (MO-AB-23702R)
Cat: MO-AB-23702R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO23702R |
Specificity | This antibody binds to Pig AMH. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate N- and C-terminal cleavage products that homodimerize and associate to form a biologically active noncovalent complex. This complex binds to the anti-Mullerian hormone receptor type 2 and causes the regression of Mullerian ducts in the male embryo that would otherwise differentiate into the uterus and fallopian tubes. This protein also plays a role in Leydig cell differentiation and function and follicular development in adult females. Mutations in this gene result in persistent Mullerian duct syndrome. |
Product Overview | This product is a mouse antibody against AMH. It can be used for AMH detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Anti-Mullerian hormone, Fragment; AMH |
UniProt ID | O18761 |
Protein Refseq | The length of the protein is 45 amino acids long. The sequence is show below: AVRHARWGPQDLANFGLCPPSLRQAALPLLQQLQAWLGEPRGQRL. |
See other products for " AMH "
MO-AB-01392H | Mouse Anti-Frog AMH Antibody (MO-AB-01392H) |
MO-AB-36692W | Mouse Anti-Goat AMH Antibody (MO-AB-36692W) |
MO-AB-14176Y | Mouse Anti-Sheep AMH Antibody (MO-AB-14176Y) |
MO-AB-00055R | Mouse Anti-Medaka AMH Antibody (MO-AB-00055R) |
MO-AB-32826H | Mouse Anti-Nile tilapia amh Antibody (MO-AB-32826H) |
MO-AB-00118Y | Mouse Anti-Chicken AMH Antibody (MO-AB-00118Y) |
MO-AB-07299R | Mouse Anti-Cattle AMH Antibody (MO-AB-07299R) |
CBMOAB-65646FYA | Mouse Anti-Zebrafish amh Antibody (CBMOAB-65646FYA) |
MO-AB-43651W | Mouse Anti-Horse AMH Antibody (MO-AB-43651W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry