Mouse Anti-Pig AXL Antibody (MO-AB-24049R)


Cat: MO-AB-24049R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO24049R
SpecificityThis antibody binds to Pig AXL.
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the Tyro3-Axl-Mer (TAM) receptor tyrosine kinase subfamily. The encoded protein possesses an extracellular domain which is composed of two immunoglobulin-like motifs at the N-terminal, followed by two fibronectin type-III motifs. It transduces signals from the extracellular matrix into the cytoplasm by binding to the vitamin K-dependent protein growth arrest-specific 6 (Gas6). This gene may be involved in several cellular functions including growth, migration, aggregation and anti-inflammation in multiple cell types. Alternative splicing results in multiple transcript variants of this gene.
Product OverviewThis product is a mouse antibody against AXL. It can be used for AXL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAXL receptor tyrosine kinase, Fragment; AXL
UniProt IDQ6JTJ1
Protein RefseqThe length of the protein is 61 amino acids long.
The sequence is show below: AEALPPAQEPDEILYVNMDEGGGHPEPLGAAGGADPPTQPDPKDSCSCLTAAEVHPAGRYV.
For Research Use Only | Not For Clinical Use.

Online Inquiry