Cat: MO-AB-24049R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO24049R |
Specificity | This antibody binds to Pig AXL. |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the Tyro3-Axl-Mer (TAM) receptor tyrosine kinase subfamily. The encoded protein possesses an extracellular domain which is composed of two immunoglobulin-like motifs at the N-terminal, followed by two fibronectin type-III motifs. It transduces signals from the extracellular matrix into the cytoplasm by binding to the vitamin K-dependent protein growth arrest-specific 6 (Gas6). This gene may be involved in several cellular functions including growth, migration, aggregation and anti-inflammation in multiple cell types. Alternative splicing results in multiple transcript variants of this gene. |
Product Overview | This product is a mouse antibody against AXL. It can be used for AXL detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | AXL receptor tyrosine kinase, Fragment; AXL |
UniProt ID | Q6JTJ1 |
Protein Refseq | The length of the protein is 61 amino acids long. The sequence is show below: AEALPPAQEPDEILYVNMDEGGGHPEPLGAAGGADPPTQPDPKDSCSCLTAAEVHPAGRYV. |
See other products for " AXL "
CBMOAB-36678FYA | Mouse Anti-Rhesus AXL Antibody (CBMOAB-36678FYA) |
MO-AB-00246Y | Mouse Anti-Chicken AXL Antibody (MO-AB-00246Y) |
MO-AB-14434W | Mouse Anti-Chimpanzee AXL Antibody (MO-AB-14434W) |
CBMOAB-24970FYC | Mouse Anti-Arabidopsis AXL Antibody (CBMOAB-24970FYC) |
CBMOAB-24971FYC | Mouse Anti-Arabidopsis AXL Antibody (CBMOAB-24971FYC) |
MO-AB-01233W | Mouse Anti-Rhesus AXL Antibody (MO-AB-01233W) |
MO-AB-01234W | Mouse Anti-Rhesus AXL Antibody (MO-AB-01234W) |
MO-AB-14435W | Mouse Anti-Chimpanzee AXL Antibody (MO-AB-14435W) |
MO-AB-14437W | Mouse Anti-Chimpanzee AXL Antibody (MO-AB-14437W) |
MO-AB-24048R | Mouse Anti-Pig AXL Antibody (MO-AB-24048R) |
For Research Use Only | Not For Clinical Use.