Mouse Anti-Pig BAK1 Antibody (MO-AB-24067R)


Cat: MO-AB-24067R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO24067R
SpecificityThis antibody binds to Pig BAK1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.
Product OverviewThis product is a mouse antibody against BAK1. It can be used for BAK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBCL2-antagonist, Fragment; BAK1
UniProt IDQ1H628
Protein RefseqThe length of the protein is 67 amino acids long.
The sequence is show below: SGPTRLPEGPDRLPRPGDPLCGRLHAASLHRPVDCAEGWLGGSPGFGKRPHPERAASSGCGSVGPVC.
For Research Use Only | Not For Clinical Use.
Online Inquiry