Mouse Anti-Pig BAK1 Antibody (MO-AB-24067R)
Cat: MO-AB-24067R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO24067R |
Specificity | This antibody binds to Pig BAK1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress. |
Product Overview | This product is a mouse antibody against BAK1. It can be used for BAK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | BCL2-antagonist, Fragment; BAK1 |
UniProt ID | Q1H628 |
Protein Refseq | The length of the protein is 67 amino acids long. The sequence is show below: SGPTRLPEGPDRLPRPGDPLCGRLHAASLHRPVDCAEGWLGGSPGFGKRPHPERAASSGCGSVGPVC. |
See other products for " Bak1 "
MO-AB-24317H | Mouse Anti-Rat Bak1 Antibody (MO-AB-24317H) |
MO-MMB-0247 | Rabbit Anti-BAK1 Antibody (Cat MO-MMB-0247) |
MO-AB-08072W | Mouse Anti-Cat BAK1 Antibody (MO-AB-08072W) |
MO-AB-51733W | Mouse Anti-Marmoset BAK1 Antibody (MO-AB-51733W) |
MO-DKB-02154W | Rabbit Anti-BAK1 Antibody (MO-DKB-02154W) |
MO-DKB-0081RA | Rabbit Anti-BAK1 Antibody (MO-DKB-0081RA) |
MO-AB-00297H | Mouse Anti-Arabidopsis BAK1 Antibody (MO-AB-00297H) |
CBMOAB-25046FYC | Mouse Anti-Arabidopsis BAK1 Antibody (CBMOAB-25046FYC) |
CBMOAB-36762FYA | Mouse Anti-Rhesus BAK1 Antibody (CBMOAB-36762FYA) |
MO-AB-13609W | Mouse Anti-Chimpanzee BAK1 Antibody (MO-AB-13609W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry