Mouse Anti-Pig CD163 Antibody (MO-AB-24431R)


Cat: MO-AB-24431R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO24431R
SpecificityThis antibody binds to Pig CD163.
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD163 (CD163 Molecule) is a Protein Coding gene. Diseases associated with CD163 include Rosai-Dorfman Disease and Non-Langerhans-Cell Histiocytosis. Among its related pathways are Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers and Binding and Uptake of Ligands by Scavenger Receptors. Gene Ontology (GO) annotations related to this gene include scavenger receptor activity. An important paralog of this gene is CD163L1.
Product OverviewThis product is a mouse antibody against CD163. It can be used for CD163 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesScavenger receptor cysteine-rich type 1 protein M130, Fragment; CD163
UniProt IDJ9SVJ5
Protein RefseqThe length of the protein is 131 amino acids long.
The sequence is show below: DIPCSGRVEVQHGDTWGTVCDSDFSLEAASVLCRELQCGTVVSLLGGAHFGEGSGQIWAEEFQCEGHESHLSLCPVAPRPDGTCSHSRDVGVVCSRYTQIRLVNGKTPCEGRVELNILGSWGSLCNSHWDM.
For Research Use Only | Not For Clinical Use.

Online Inquiry