Mouse Anti-Pig CD72 Antibody (MO-AB-24481R)


Cat: MO-AB-24481R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO24481R
SpecificityThis antibody binds to Pig CD72.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD72 (CD72 Molecule) is a Protein Coding gene. Diseases associated with CD72 include Small Intestine Lymphoma and Leukemia, Chronic Lymphocytic. Among its related pathways are Semaphorin interactions and Developmental Biology. Gene Ontology (GO) annotations related to this gene include receptor binding and carbohydrate binding.
Product OverviewThis product is a mouse antibody against CD72. It can be used for CD72 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD72 antigen transcript variant 3; CD72
UniProt IDA2T1K7
Protein RefseqThe length of the protein is 365 amino acids long.
The sequence is show below: MAEAITYADLRFVKAPLKKSVSSRLGQDPEADEDGELTYENVQVPPGPGGPSILAPSGLGNNTGAQTEQPTAAWSSSTSPAARRILPRCARYFLLGLLLTCLLLGVAAICLGMRYLQVSRQLQQMSRVLEATNSTLRQQLRLKITQLGQREEDLQGSRKELAQSKETLQMEQKICQTTREELQACQLDRKTTDEALKNKEVQRINLERRLRSMQDTLKPFFTCSSPDTCCPVGWILNERSCFYISVDERSWEESQSHCKSLSSNLAKMTDILYSYGRYFHAYYPGSKALTHRNSLESYWIGLRYQNNFWKWTDGTRYTAFFARGPGCVKVESKTHHMEKEDCHASLPSLCEMAAFKHPDEDYAGL.
See other products for " CD72 "
CBMOAB-38736FYAMouse Anti-Rhesus CD72 Antibody (CBMOAB-38736FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry