Cat: MO-AB-28681R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO28681R |
Specificity | This antibody binds to Pig PTPN1. |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | This product is a mouse antibody against PTPN1. It can be used for PTPN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Tyrosine phosphatase non-receptor type 1, Fragment; PTPN1 |
UniProt ID | Q2I6Y5 |
Protein Refseq | The length of the protein is 62 amino acids long. The sequence is show below: HFHYTTWPDFGVPESPASFLNFLFKVRESGSLSLEHGPIVVHCSAGIGRSGTFCLADTCLLL. |
See other products for " ptpn1 "
CBMOAB-94517FYA | Mouse Anti-Zebrafish ptpn1 Antibody (CBMOAB-94517FYA) |
MO-AB-08293W | Mouse Anti-Cat PTPN1 Antibody (MO-AB-08293W) |
MO-AB-28679R | Mouse Anti-Pig PTPN1 Antibody (MO-AB-28679R) |
CBMOAB-00292FYA | Rabbit Anti-Zebrafish PTPN1 Antibody (CBMOAB-00292FYA) |
CBMOAB-94520FYA | Mouse Anti-Zebrafish ptpn1 Antibody (CBMOAB-94520FYA) |
CBMOAB-94519FYA | Mouse Anti-Zebrafish ptpn1 Antibody (CBMOAB-94519FYA) |
MO-AB-62570W | Mouse Anti-Marmoset PTPN1 Antibody (MO-AB-62570W) |
MO-AB-18824R | Mouse Anti-Cattle PTPN1 Antibody (MO-AB-18824R) |
CBMOAB-94521FYA | Mouse Anti-Zebrafish ptpn1 Antibody (CBMOAB-94521FYA) |
CBMOAB-94518FYA | Mouse Anti-Zebrafish ptpn1 Antibody (CBMOAB-94518FYA) |
For Research Use Only | Not For Clinical Use.