AibGenesis™ Mouse Anti-Pqbp1 Antibody (CBMOAB-28173FYA)


Cat: CBMOAB-28173FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-28173FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO28173FYA 100 µg
CBMOAB-55258FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO55258FYA 100 µg
CBMOAB-93763FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO93763FYA 100 µg
MO-AB-05334W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05334W 100 µg
MO-AB-06514H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06514C 100 µg
MO-AB-18412R Monoclonal Cattle (Bos taurus) WB, ELISA MO18412R 100 µg
MO-AB-21644W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21644W 100 µg
MO-AB-28554R Monoclonal Pig (Sus scrofa) WB, ELISA MO28554R 100 µg
MO-AB-62200W Monoclonal Marmoset WB, ELISA MO62200W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO28173FYA
SpecificityThis antibody binds to fruit fly Pqbp1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Pqbp1 Antibody is a mouse antibody against Pqbp1. It can be used for Pqbp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG11820; LD40504p; PQBP1
UniProt IDQ9VBY6
Protein RefseqThe length of the protein is 231 amino acids long.
The sequence is show below: MSLPAALLQRLKKRGLVTKQSGAAPISEAIEEIIAENYDDDDKSGPYPYKEDTSPEPKRRSVEEKFWSHRIKERIGVNESYHGYKLCPNKYNIYHKCSLYCVNKFNSSPLSQPSHRYLKRYKRLLRKYPLEAGWKDVYDKGCKAFYFYNSTTQTVSWLPPSHPKARITNSAAVFRRQLANSNDEFNFDTNMVQPKSSNQNEPDEPDVFVPAKKQKSRDLERKIQRRRRNDN.
For Research Use Only | Not For Clinical Use.
Online Inquiry