Mouse Anti-Rabbit AdipoR1 Antibody (MO-AB-07093Y)
Cat: MO-AB-07093Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rabbit (Oryctolagus cuniculus) |
Clone | MO07093Y |
Specificity | This antibody binds to Rabbit AdipoR1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014] |
Product Overview | This product is a mouse antibody against AdipoR1. It can be used for AdipoR1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adiponectin receptor type I; adipoR1 |
UniProt ID | B0JDQ3 |
Protein Refseq | The length of the protein is 81 amino acids long. The sequence is show below: LDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTI. |
See other products for " ADIPOR1 "
MO-DKB-03602W | Rabbit Anti-ADIPOR1 (AA 1-100, clone ms2109-010) Antibody (Cat MO-DKB-03602W) |
MO-AB-22813H | Mouse Anti-Mallard AdipoR1 Antibody (MO-AB-22813H) |
MOFY-1222-FY124 | Rabbit Anti-ADIPOR1 Antibody (MOFY-1222-FY124) |
CBMOAB-18521FYB | Mouse Anti-Rice ADIPOR1 Antibody (CBMOAB-18521FYB) |
MO-AB-23569R | Mouse Anti-Pig ADIPOR1 Antibody (MO-AB-23569R) |
MO-NAB-00383W | Rabbit Anti-ADIPOR1 Antibody (N-terminal) |
MO-AB-24664W | Mouse Anti-Chimpanzee ADIPOR1 Antibody (MO-AB-24664W) |
MO-AB-50500W | Mouse Anti-Marmoset ADIPOR1 Antibody (MO-AB-50500W) |
CBMOAB-00283FYA | Rabbit Anti-Mouse ADIPOR1 Antibody (CBMOAB-00283FYA) |
MO-AB-01257H | Mouse Anti-Frog adipor1 Antibody (MO-AB-01257H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry