Mouse Anti-Rabbit AdipoR2 Antibody (MO-AB-07094Y)


Cat: MO-AB-07094Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRabbit (Oryctolagus cuniculus)
CloneMO07094Y
SpecificityThis antibody binds to Rabbit AdipoR2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin (Yamauchi et al., 2003 [PubMed 12802337]).
Product OverviewThis product is a mouse antibody against AdipoR2. It can be used for AdipoR2 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdiponectin receptor type II; adipoR2
UniProt IDB0JDQ2
Protein RefseqThe length of the protein is 69 amino acids long. The sequence is show below: QAHMLLERMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWT.
For Research Use Only | Not For Clinical Use.
Online Inquiry