Mouse Anti-Rabbit AdipoR2 Antibody (MO-AB-07094Y)
Cat: MO-AB-07094Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rabbit (Oryctolagus cuniculus) |
Clone | MO07094Y |
Specificity | This antibody binds to Rabbit AdipoR2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin (Yamauchi et al., 2003 [PubMed 12802337]). |
Product Overview | This product is a mouse antibody against AdipoR2. It can be used for AdipoR2 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adiponectin receptor type II; adipoR2 |
UniProt ID | B0JDQ2 |
Protein Refseq | The length of the protein is 69 amino acids long. The sequence is show below: QAHMLLERMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWT. |
See other products for " ADIPOR2 "
CBMOAB-35228FYA | Mouse Anti-Rhesus ADIPOR2 Antibody (CBMOAB-35228FYA) |
CBMOAB-18522FYB | Mouse Anti-Rice ADIPOR2 Antibody (CBMOAB-18522FYB) |
CBMOAB-65037FYA | Mouse Anti-Zebrafish adipor2 Antibody (CBMOAB-65037FYA) |
MO-AB-50501W | Mouse Anti-Marmoset ADIPOR2 Antibody (MO-AB-50501W) |
MO-AB-01259H | Mouse Anti-Frog adipor2 Antibody (MO-AB-01259H) |
MO-AB-20760W | Mouse Anti-Chimpanzee ADIPOR2 Antibody (MO-AB-20760W) |
MO-AB-00058Y | Mouse Anti-Chicken ADIPOR2 Antibody (MO-AB-00058Y) |
MO-AB-07056R | Mouse Anti-Cattle ADIPOR2 Antibody (MO-AB-07056R) |
MO-AB-22814H | Mouse Anti-Mallard ADIPOR2 Antibody (MO-AB-22814H) |
MO-AB-36674W | Mouse Anti-Goat ADIPOR2 Antibody (MO-AB-36674W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry