Mouse Anti-Rabbit ITGB1 Antibody (MO-AB-08512Y)

Cat: MO-AB-08512Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details


Host speciesMouse (Mus musculus)
Species ReactivityRabbit (Oryctolagus cuniculus)
SpecificityThis antibody binds to Rabbit ITGB1.
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.


Product OverviewThis product is a mouse antibody against ITGB1. It can be used for ITGB1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesIntegrin beta 1; integrin; beta; 1
UniProt IDQ28898
Protein RefseqThe length of the protein is 63 amino acids long. The sequence is show below: VVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK.
For Research Use Only | Not For Clinical Use.

Online Inquiry