Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Rabbit ITGB1 Antibody (MO-AB-08512Y)


Cat: MO-AB-08512Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRabbit (Oryctolagus cuniculus)
CloneMO08512Y
SpecificityThis antibody binds to Rabbit ITGB1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against ITGB1. It can be used for ITGB1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesIntegrin beta 1; integrin; beta; 1
UniProt IDQ28898
Protein RefseqThe length of the protein is 63 amino acids long. The sequence is show below: VVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK.

See other products for " ITGB1 "

CBMOAB-45643FYAMouse Anti-Rhesus ITGB1 Antibody (CBMOAB-45643FYA)
MO-AB-33324HMouse Anti-Nile tilapia itgb1 Antibody (MO-AB-33324H)
MO-AB-20956WMouse Anti-Chimpanzee ITGB1 Antibody (MO-AB-20956W)
CBMOAB-45644FYAMouse Anti-Rhesus ITGB1 Antibody (CBMOAB-45644FYA)
MO-AB-04559HMouse Anti-Frog itgb1 Antibody (MO-AB-04559H)
MO-AB-26750RMouse Anti-Pig ITGB1 Antibody (MO-AB-26750R)
MO-AB-02604YMouse Anti-Chicken ITGB1 Antibody (MO-AB-02604Y)
MO-AB-26749RMouse Anti-Pig ITGB1 Antibody (MO-AB-26749R)
MO-AB-26748RMouse Anti-Pig ITGB1 Antibody (MO-AB-26748R)
MO-AB-57415WMouse Anti-Marmoset ITGB1 Antibody (MO-AB-57415W)
For Research Use Only | Not For Clinical Use.

Online Inquiry