Mouse Anti-Rabbit TP53 Antibody (MO-AB-10286Y)
Cat: MO-AB-10286Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rabbit (Oryctolagus cuniculus) |
Clone | MO10286Y |
Specificity | This antibody binds to Rabbit TP53. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Cytoskeleton; Endoplasmic reticulum; Nucleus; Mitochondrion |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. Its pro-apoptotic activity is activated via its interaction with PPP1R13B/ASPP1 or TP53BP2/ASPP2 (By similarity). However, this activity is inhibited when the interaction with PPP1R13B/ASPP1 or TP53BP2/ASPP2 is displaced by PPP1R13L/iASPP (By similarity). In cooperation with mitochondrial PPIF is involved in activating oxidative stress-induced necrosis; the function is largely independent of transcription. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression. Induces the transcription of long intergenic non-coding RNA p21 (lincRNA-p21) and lincRNA-Mkln1. LincRNA-p21 participates in TP53-dependent transcriptional repression leading to apoptosis and seems to have an effect on cell-cycle regulation. Regulates the circadian clock by repressing CLOCK-ARNTL/BMAL1-mediated transcriptional activation of PER2. |
Product Overview | This product is a mouse antibody against TP53. It can be used for TP53 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cellular tumor antigen p53; Tumor suppressor p53; TP53 |
UniProt ID | Q95330 |
Protein Refseq | The length of the protein is 391 amino acids long. The sequence is show below: MEESQSDLSLEPPLSQETFSDLWKLLPENNLLTTSLNPPVDDLLSAEDVANWLNEDPEEGLRVPAAPAPEAPAPAAPALAAPAPATSWPLSSSVPSQKTYHGNYGFRLGFLHSGTAKSVTCTYSPCLNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCPELPPGSSKRALPTTTTDSSPQTKKKPLDGEYFILKIRGRERFEMFRELNEALELKDAQAEKEPGGSRAHSSYLKAKKGQSTSRHKKPMFKREGPDSD. |
See other products for " tp53 "
CBMOAB-10409FYB | Mouse Anti-Zebrafish tp53 Antibody (CBMOAB-10409FYB) |
MO-NAB-00332W | Rabbit Anti-TP53 Antibody (AA 1-100) |
MO-NAB-00233W | Mouse Anti-Yeast TP53 (AA 14-389, clone NW0129) Antibody (MO-NAB-00233W) |
MO-AB-01778R | Mouse Anti-Medaka TP53 Antibody (MO-AB-01778R) |
MO-AB-08632H | Mouse Anti-Frog tp53 Antibody (MO-AB-08632H) |
MO-AB-66716W | Mouse Anti-Marmoset TP53 Antibody (MO-AB-66716W) |
MO-NAB-00484W | Mouse Anti-Zebrafish TP53 Antibody (C-terminal) |
MO-AB-18041Y | Mouse Anti-Sheep TP53 Antibody (MO-AB-18041Y) |
MO-AB-33798W | Mouse Anti-Dog TP53 Antibody (MO-AB-33798W) |
MO-NAB-00511W | Mouse Anti-Zebrafish TP53 Antibody (C-terminal) |
For Research Use Only | Not For Clinical Use.
Online Inquiry