AibGenesis™ Mouse Anti-Rac1 Antibody (CBMOAB-28698FYA)
Cat: CBMOAB-28698FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-28698FYA | Monoclonal | Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Horse (Equus caballus), Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio), Marmoset, O. mykiss (Oncorhynchus mykiss), Rice (Oryza) | WB, ELISA | MO28698FYA | 100 µg | ||
| CBMOAB-39741FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO39741FC | 100 µg | ||
| CBMOAB-88996FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO88996FYB | 100 µg | ||
| MO-AB-01243L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01243L | 100 µg | ||
| MO-AB-06848H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO06848C | 100 µg | ||
| MO-AB-09633Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09633Y | 100 µg | ||
| MO-AB-12937Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO12937Y | 100 µg | ||
| MO-AB-17468Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17468Y | 100 µg | ||
| MO-AB-18978R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO18978R | 100 µg | ||
| MO-AB-22069W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22069W | 100 µg | ||
| MO-AB-28309H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28309C | 100 µg | ||
| MO-AB-33034W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33034W | 100 µg | ||
| MO-AB-62863W | Monoclonal | Marmoset | WB, ELISA | MO62863W | 100 µg | ||
| MO-DKB-03395W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Horse (Equus caballus), Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio), Marmoset, O. mykiss (Oncorhynchus mykiss), Rice (Oryza) |
| Clone | MO28698FYA |
| Specificity | This antibody binds to fruit fly Rac1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Cytosol; Plasma membrane; Cytoskeleton; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-D. melanogaster Rac1 Antibody is a mouse antibody against Rac1. It can be used for Rac1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Ras-related protein Rac1; Rac1; RacA |
| UniProt ID | P40792 |
| Protein Refseq | The length of the protein is 192 amino acids long. The sequence is show below: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRKCALL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry