Mouse Anti-Adgrv1 Antibody (MO-AB-23977H)


Cat: MO-AB-23977H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
  • QC data
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-23977H Monoclonal Rat (Rattus norvegicus), Rat, Rhesus (Macaca mulatta) WB, ELISA MO23977C 100 µg
MO-AB-03347W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03347W 100 µg
MOFY-0223-FY9 Monoclonal Rat WB, ELISA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Rat, Rhesus (Macaca mulatta)
CloneMO23977C
SpecificityThis antibody binds to Rat Adgrv1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the G-protein coupled receptor superfamily. The encoded protein contains a 7-transmembrane receptor domain, binds calcium and is expressed in the central nervous system. Mutations in this gene are associated with Usher syndrome 2 and familial febrile seizures. Several alternatively spliced transcripts have been described.
Product OverviewThis product is a mouse antibody against Adgrv1. It can be used for Adgrv1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Gpr98; Gpr98
UniProt IDF1LTQ4
Protein RefseqThe length of the protein is 254 amino acids long.
The sequence is show below: CFIPNIYAALFTAALVPLMCLVVVFVVFIHAYQLKPQWKGYDDVFRGRTNAAEIPLILYLFALISLTWLWGGLHMAYRHFWMLVLFVIFNSLQGLYVFVVYFILHNQTCCPMKASYTVEMNGHPGPSTAFFTPGSGIPPAGEMNKSTQNLINAMEEVPSDWERVSFQQTSQASPDLKTSPQNGASFPSSGGYGQGSLIADEESQEFDDLIFALKTGAGLSVSDNESGQGSQEGGTLTDSQIVELRRIPIADTHL.

Relate Reference Data

SDS-PAGE

Figure 1 Mouse Anti-Rat Adgrv1 Antibody in SDS-PAGE.
SDS-PAGE analysis of MO-AB-23977H in reduced conditions. Gel stained for 30 minutes with Coomassie Blue. As a result of different β-mercaptoethanol-reduced proteins (Heavy chain and Light chain) migrate as about 50 kDa and 25 kDa, respectively.

ELISA

Figure 2 Mouse Anti-Rat Adgrv1 Antibody in ELISA.
ELISA analysis of MO-AB-23977H was performed by coating with Rat Adgrv1 antigen peptide (GAGLSVSDN).
The abscissa represents the antibody dilution fold (*k).

For Research Use Only | Not For Clinical Use.
Online Inquiry