Mouse Anti-Rat Alg14 Antibody (MO-AB-24033H)


Cat: MO-AB-24033H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24033C
SpecificityThis antibody binds to Rat Alg14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the glycosyltransferase 1 family. The encoded protein and ALG13 are thought to be subunits of UDP-GlcNAc transferase, which catalyzes the first two committed steps in endoplasmic reticulum N-linked glycosylation. Mutations in this gene have been linked to congenital myasthenic syndrome (CMSWTA). Alternatively spliced transcript variants have been identified.
Product OverviewThis product is a mouse antibody against Alg14. It can be used for Alg14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUDP-N-acetylglucosamine transferase subunit ALG14 homolog; Alg14
UniProt IDQ6AY85
Protein RefseqThe length of the protein is 216 amino acids long.
The sequence is show below: MVCVLTLAASAGGLAVLLIVRLWAVLRSHPVTPRQSLGLLIVAGSGGHTAEILRLVGSLSGAYSPRHYVIAESDEMSAKKIHSLELARAQNDSTTEHTEYYLHRIPRSREVRQSWLSSVFTTLYSIWFSFPLVHRIKPDLVLCNGPGTCVPICVSALLLGILGIKKVIIVYVESICRVETLSLSGKILWHLSDYFIVQWPTLKEKYPKSVYLGRIV.
For Research Use Only | Not For Clinical Use.
Online Inquiry