Mouse Anti-Rat Asip Antibody (MO-AB-24205H)


Cat: MO-AB-24205H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24205C
SpecificityThis antibody binds to Rat Asip.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionIn mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes.
Product OverviewThis product is a mouse antibody against Asip. It can be used for Asip detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAgouti-signaling protein; ASP; Agouti switch protein; Asip; A
UniProt IDQ99JA2
Protein RefseqThe length of the protein is 131 amino acids long.
The sequence is show below: MDVTRLLLATLVGFLCFLTVHSHLVFEETLGDDRSLKSNSSINSLDFSSVSIVALNKKSKKISRKEAEKRKRSSKKKASIKKVARPPPPSPCVATRDSCKPPAPACCNPCASCQCRFFGSACTCRVLNPNC.
See other products for " ASIP "
MO-AB-43738WMouse Anti-Horse ASIP Antibody (MO-AB-43738W)
MO-AB-08795WMouse Anti-Cat ASIP Antibody (MO-AB-08795W)
MO-AB-36713WMouse Anti-Goat asip Antibody (MO-AB-36713W)
MO-AB-00192YMouse Anti-Chicken Asip Antibody (MO-AB-00192Y)
MO-AB-22968HMouse Anti-Mallard ASIP Antibody (MO-AB-22968H)
MO-AB-07268YMouse Anti-Rabbit Asip Antibody (MO-AB-07268Y)
MO-AB-29057WMouse Anti-Dog ASIP Antibody (MO-AB-29057W)
MO-AB-10678YMouse Anti-O. mykiss Asip Antibody (MO-AB-10678Y)
MO-AB-38445WMouse Anti-Gorilla ASIP Antibody (MO-AB-38445W)
MO-AB-14265YMouse Anti-Sheep ASIP Antibody (MO-AB-14265Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry