Mouse Anti-Rat Bak1 Antibody (MO-AB-24317H)


Cat: MO-AB-24317H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24317C
SpecificityThis antibody binds to Rat Bak1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations; Cytosol; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.
Product OverviewThis product is a mouse antibody against Bak1. It can be used for Bak1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBAK protein; BCL2-antagonist/killer 1, isoform CRA_b; Bak1 protein; Protein Bak1; Bak1; Bak
UniProt IDQ9JK59
Protein RefseqThe length of the protein is 209 amino acids long.
The sequence is show below: MASGQGPGPPKGDCDEALSASEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDNLSLEPNSVLGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSGISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALSLRRDPILSVVVIFGVVLLGQFVVHRFFRS.
See other products for " BAK1 "
MO-MMB-0247Rabbit Anti-BAK1 Antibody (Cat MO-MMB-0247)
MO-DKB-02154WRabbit Anti-BAK1 Antibody (MO-DKB-02154W)
MO-AB-08072WMouse Anti-Cat BAK1 Antibody (MO-AB-08072W)
MOFAB-202WRabbit Anti-BAK1 Antibody (MOFAB-202W)
MO-AB-51733WMouse Anti-Marmoset BAK1 Antibody (MO-AB-51733W)
MO-AB-01798HMouse Anti-Frog bak1 Antibody (MO-AB-01798H)
MO-AB-24067RMouse Anti-Pig BAK1 Antibody (MO-AB-24067R)
MO-AB-07959RMouse Anti-Cattle BAK1 Antibody (MO-AB-07959R)
MO-AB-00297HMouse Anti-Arabidopsis BAK1 Antibody (MO-AB-00297H)
CBMOAB-36762FYAMouse Anti-Rhesus BAK1 Antibody (CBMOAB-36762FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry