Mouse Anti-Rat Cd209 Antibody (MO-AB-24615H)


Cat: MO-AB-24615H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24615C
SpecificityThis antibody binds to Rat Cd209.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD209 (CD209 Molecule) is a protein coding gene. Diseases associated with CD209 include Dengue Virus and Human Immunodeficiency Virus Type 1. Among its related pathways are CLEC7A (Dectin-1) signaling and Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers. Gene Ontology (GO) annotations related to this gene include carbohydrate binding and mannose binding. An important paralog of this gene is CLEC4M.
Product OverviewThis product is a mouse antibody against Cd209. It can be used for Cd209 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Clec4m; Similar to SIGNR3; Clec4m
UniProt IDD3ZXN3
Protein RefseqThe length of the protein is 237 amino acids long.
The sequence is show below: MSESMESNTQQLDNPEDEEYLMSGSRYSIISSRLRTKFGIKSLAEYTKQSHNPLVLPLLSFLFLAGLLLIILVLVSKVPSSEVQDKIYQELMQLKTEVHDGLCQPCPRDWTFFNGSCYFFSKSQRNWHNSITACKELGAQLVIVETDEEQTFLQQTSKTRGPTWMGLSDMHNEATWHWVDGSPLSPSFAQYWNRGEPNNVGDEDCAEFSGDGWNDLRCDTRIFWICKKVSTSSCTIK.
See other products for " CD209 "
CBMOAB-38668FYAMouse Anti-Rhesus CD209 Antibody (CBMOAB-38668FYA)
MO-AB-10831YMouse Anti-O. mykiss CD209 Antibody (MO-AB-10831Y)
MO-AB-24440RMouse Anti-Pig CD209 Antibody (MO-AB-24440R)
MO-AB-09798RMouse Anti-Cattle CD209 Antibody (MO-AB-09798R)
MO-AB-29452WMouse Anti-Dog CD209 Antibody (MO-AB-29452W)
MO-DKB-00767WRabbit Anti-CD209 Antibody (MO-DKB-00767W)
MO-AB-23447WMouse Anti-Chimpanzee cd209 Antibody (MO-AB-23447W)
CBMOAB-00033FYAMouse Anti-Cattle CD209 Antibody (CBMOAB-00033FYA)
CBMOAB-69663FYAMouse Anti-Zebrafish cd209 Antibody (CBMOAB-69663FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry