Cat: MO-AB-24979H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO24979C |
Specificity | This antibody binds to Rat Cop1. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2 weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Golgi apparatus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | COP1 (COP1, E3 Ubiquitin Ligase) is a protein coding gene. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and Direct p53 effectors. An important paralog of this gene is RBBP4. |
Product Overview | This product is a mouse antibody against Cop1. It can be used for Cop1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein Rfwd2; Rfwd2 |
UniProt ID | A0A096MJC2 |
Protein Refseq | The length of the protein is 57 amino acids long. The sequence is show below: XNELILKQKQRFEEKRFKLDHSNGHRWQIFQDLLGTDQDNLDLANVNLMWSESLSKK. |
See other products for " Cop1 "
MO-AB-24978H | Mouse Anti-Rat Cop1 Antibody (MO-AB-24978H) |
CBMOAB-26415FYC | Mouse Anti-Arabidopsis COP1 Antibody (CBMOAB-26415FYC) |
MO-AB-34309H | Mouse Anti-Tomato COP1 Antibody (MO-AB-34309H) |
MO-DKB-02184W | Rabbit Anti-COP1 Antibody (MO-DKB-02184W) |
CBMOAB-00787CR | Mouse Anti-Yeast COP1 Antibody (CBMOAB-00787CR) |
MO-DKB-04011W | Rabbit Anti-COP1 (C-terminal) Antibody (Cat MO-DKB-04011W) |
MO-AB-23878W | Mouse Anti-Chimpanzee COP1 Antibody (MO-AB-23878W) |
MO-AB-53383W | Mouse Anti-Marmoset COP1 Antibody (MO-AB-53383W) |
MO-DKB-04012W | Rabbit Anti-COP1 (Center) Antibody (Cat MO-DKB-04012W) |
MO-AB-38967W | Mouse Anti-Grape COP1 Antibody (MO-AB-38967W) |
For Research Use Only | Not For Clinical Use.