Mouse Anti-Rat Mrp4 Antibody (MO-AB-27186H)
Cat: MO-AB-27186H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO27186C |
Specificity | This antibody binds to Rat Mrp4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane. |
Product Overview | This product is a mouse antibody against Mrp4. It can be used for Mrp4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Multidrug resistance protein 4; Abcc4; Mrp4 |
UniProt ID | Q91Y23 |
Protein Refseq | The length of the protein is 67 amino acids long. The sequence is show below: KMDTELAESGSNFSVGQRQLVCLARAILKKNRILIIDEATANVDPRTDELIQQKIREKFAQCTVLTI. |
See other products for " MRP4 "
MO-AB-48748W | Mouse Anti-Maize MRP4 Antibody (MO-AB-48748W) |
CBMOAB-06791HCB | Mouse Anti-C. elegans MRP4 Antibody (CBMOAB-06791HCB) |
CBMOAB-24678FYA | Mouse Anti-D. melanogaster Mrp4 Antibody (CBMOAB-24678FYA) |
CBMOAB-00046CR | Mouse Anti-Yeast MRP4 Antibody (CBMOAB-00046CR) |
CBMOAB-34706FYB | Mouse Anti-Rice mrp4 Antibody (CBMOAB-34706FYB) |
MO-AB-08862Y | Mouse Anti-Rabbit MRP4 Antibody (MO-AB-08862Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry