Mouse Anti-Rat Taf3 Antibody (MO-AB-29338H)


Cat: MO-AB-29338H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO29338C
SpecificityThis antibody binds to Rat Taf3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFunctions as a component of the DNA-binding general transcription factor complex TFIID. Binding of TFIID to a promoter (with or without TATA element) is the initial step in pre-initiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription.
Product OverviewThis product is a mouse antibody against Taf3. It can be used for Taf3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Taf3; Taf3
UniProt IDD3ZPB7
Protein RefseqThe length of the protein is 188 amino acids long.
The sequence is show below: FPQIKVEPVIPAPSPVIPRLTLRVGAGQDKIVISKVVPAPEAKPAPSLNRPKTPPPAPVPIPVRVSPTPLPPPLLAQAAVCPALMPSPAPALSAAGSAKAPVRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKHKRRKHRAH.
For Research Use Only | Not For Clinical Use.
Online Inquiry