AibGenesis™ Mouse Anti-Rbp4 Antibody (CBMOAB-28843FYA)
Cat: CBMOAB-28843FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-28843FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Bovine, Human, Mouse, Pig, Goat, Sheep, Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO28843FYA | 100 µg | ||
| CBMOAB-56227FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO56227FYA | 100 µg | ||
| CBMOAB-95538FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO95538FYA | 100 µg | ||
| MO-AB-08145W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08145W | 100 µg | ||
| MO-AB-19633W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO19633W | 100 µg | ||
| MO-AB-63103W | Monoclonal | Marmoset | WB, ELISA | MO63103W | 100 µg | ||
| MO-AB-19138R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19138R | 100 µg | ||
| MO-AB-28769R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28769R | 100 µg | ||
| MO-AB-06988H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO06988C | 100 µg | ||
| MO-AB-28382H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28382C | 100 µg | ||
| MO-AB-09668Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09668Y | 100 µg | ||
| MOFY-0722-FY43 | Monoclonal | Bovine, Human, Mouse | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY307 | Polyclonal | Bovine, Human, Pig, Goat, Sheep | WB, IHC, ICC, IP | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Bovine, Human, Mouse, Pig, Goat, Sheep, Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO28843FYA |
| Specificity | This antibody binds to fruit fly Rbp4. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-D. melanogaster Rbp4 Antibody is a mouse antibody against Rbp4. It can be used for Rbp4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | RNA-binding protein 4; Rbp4 |
| UniProt ID | Q9VFT3 |
| Protein Refseq | The length of the protein is 428 amino acids long. The sequence is show below: MDAGNCASSACLGDCKGDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKADRRFRFPIFSSVRAGYIPPQPATADSYNYNNPNYNPYLAQSVLPPSAFTNGWAHYVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHGPDMWSSYPKTGIYSAQEWTSSKVAEWGPKAGHKHAQTSTNDRAKIDLKELQAATFNNKLDFGARGDADRMSGAGLGLGLTGGAAVGVGAIKKWPTQDYKVFKPAKSPTNGVIPKIGKEATTPPYGI. |
See other products for " RBP4 "
For Research Use Only | Not For Clinical Use.
Online Inquiry