AibGenesis™ Mouse Anti-Rheb Antibody (CBMOAB-29632FYA)
Cat: CBMOAB-29632FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-29632FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Primate, Sheep (Ovis aries), Frog (Xenopus), Zebrafish (Danio rerio), Marmoset | WB, ELISA | MO29632FYA | 100 µg | ||
| CBMOAB-95909FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO95909FYA | 100 µg | ||
| MO-AB-07100H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07100C | 100 µg | ||
| MO-AB-19265R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19265R | 100 µg | ||
| MO-AB-21764W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21764W | 100 µg | ||
| MO-AB-28475H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28475C | 100 µg | ||
| MO-AB-28803R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28803R | 100 µg | ||
| MO-AB-63278W | Monoclonal | Marmoset | WB, ELISA | MO63278W | 100 µg | ||
| MO-DKB-03263W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Primate, Sheep (Ovis aries), Frog (Xenopus), Zebrafish (Danio rerio) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Primate, Sheep (Ovis aries), Frog (Xenopus), Zebrafish (Danio rerio), Marmoset |
| Clone | MO29632FYA |
| Specificity | This antibody binds to fruit fly Rheb. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Golgi apparatus; Cytosol; Endoplasmic reticulum; Other locations; Plasma Membrane |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene is a member of the small GTPase superfamily and encodes a lipid-anchored, cell membrane protein with five repeats of the RAS-related GTP-binding region. This protein is vital in regulation of growth and cell cycle progression due to its role in the insulin/TOR/S6K signaling pathway. The protein has GTPase activity and shuttles between a GDP-bound form and a GTP-bound form, and farnesylation of the protein is required for this activity. Three pseudogenes have been mapped, two on chromosome 10 and one on chromosome 22. (From NCBI) |
| Product Overview | Mouse Anti-D. melanogaster Rheb Antibody is a mouse antibody against Rheb. It can be used for Rheb detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | GTP-binding protein Rheb homolog; Rheb |
| UniProt ID | Q9VND8 |
| Protein Refseq | The length of the protein is 182 amino acids long. The sequence is show below: MPTKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIENENGNPQEKSGCLVS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry