Mouse Anti-Rhesus 8D6 protein (clone MO34731FYA) Antibody (CBMOAB-34731FYA)


Cat: CBMOAB-34731FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34731FYA
SpecificityThis antibody binds to Rhesus 8D6 protein.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionLacks conserved residue(s) required for the propagation of feature annotation.
Product OverviewMouse Anti-Rhesus 8D6 protein (clone MO34731FYA) Antibody (CBMOAB-34731FYA) is a mouse antibody against 8D6 protein. It can be used for 8D6 protein detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names8D6 antigen
UniProt IDG7NNA0
Protein RefseqThe length of the protein is 282 amino acids long.
The sequence is show below: TSGWMARGGAQRTGALGLALRLLLGLGLGLEVAATPLSTRTSAQASGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDFDCSDGSDEEECRIEPCTQNGQCPPPPGLPCPCTGVSDCSGRTDKKLRNCSRPACPAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTHLRGWGGLVGRWAHPLPGTNETLLKGDATTTGPPVTPESVTSVENVTSSSAGNQSGSPGVYGVIAAAAVLSASLVAVTLLLLSWLRAQERLRPLGLLVAMKESLLLSERKTSLP.
For Research Use Only | Not For Clinical Use.

Online Inquiry