Mouse Anti-Rhesus A2ML1 (clone MO34742FYA) Antibody (CBMOAB-34742FYA)


Cat: CBMOAB-34742FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34742FYA
SpecificityThis antibody binds to Rhesus A2ML1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the alpha-macroglobulin superfamily. The encoded protein is thought to be an N-glycosylated monomeric protein that acts as an inhibitor of several proteases. It has been shown to form covalent interactions with proteases, and has been reported as the p170 antigen recognized by autoantibodies in the autoimmune disease paraneoplastic pemphigus (PNP; PMID:20805888). Mutations in these gene have also been associated with some cases of Noonan syndrome (NS; PMID:24939586) as well as some cases of otitis media (PMID:26121085). Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Rhesus A2ML1 (clone MO34742FYA) Antibody (CBMOAB-34742FYA) is a mouse antibody against A2ML1. It can be used for A2ML1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlpha-2-macroglobulin-like protein 1; A2ML1
UniProt IDH9FHX0
Protein RefseqThe length of the protein is 208 amino acids long.
The sequence is show below: MVELQDPNSNRIAQWLEVAPEQGIVDLSFQLAPEAMLGTYTVAVAEGKTFGTFSVEEYVLPKFKVEVVEPKELSTVQESFLVKICCRYTYGKPMLGAVQVSVCQKAHTYWYRQVEREQLPDKCRNFSGQTDKTGCFSAPVDMATFDLIGYAYNHQINIVATVVEEGTGVEANATQNIYISPQMGSMTFEDTSNFYHPNFPFSGKIRVR.
For Research Use Only | Not For Clinical Use.

Online Inquiry