Cat: CBMOAB-34743FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO34743FYA |
Specificity | This antibody binds to Rhesus A2ML1. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the alpha-macroglobulin superfamily. The encoded protein is thought to be an N-glycosylated monomeric protein that acts as an inhibitor of several proteases. It has been shown to form covalent interactions with proteases, and has been reported as the p170 antigen recognized by autoantibodies in the autoimmune disease paraneoplastic pemphigus (PNP; PMID:20805888). Mutations in these gene have also been associated with some cases of Noonan syndrome (NS; PMID:24939586) as well as some cases of otitis media (PMID:26121085). Alternative splicing results in multiple transcript variants encoding different isoforms. |
Product Overview | Mouse Anti-Rhesus A2ML1 (clone MO34743FYA) Antibody (CBMOAB-34743FYA) is a mouse antibody against A2ML1. It can be used for A2ML1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Alpha-2-macroglobulin-like protein 1; A2ML1 |
UniProt ID | H9FK02 |
Protein Refseq | The length of the protein is 74 amino acids long. The sequence is show below: EEVATIRVSGVGNNISFEEKKKVLIQRQGSGTFVQTDKPIYTPGQQVYFRIVTMDSNFVPVNDKYSMVELQDPN. |
See other products for " A2ML1 "
CBMOAB-34742FYA | Mouse Anti-Rhesus A2ML1 Antibody (CBMOAB-34742FYA) |
MO-AB-43537W | Mouse Anti-Horse A2ML1 Antibody (MO-AB-43537W) |
CBMOAB-34740FYA | Mouse Anti-Rhesus A2ML1 Antibody (CBMOAB-34740FYA) |
CBMOAB-34739FYA | Mouse Anti-Rhesus A2ML1 Antibody (CBMOAB-34739FYA) |
CBMOAB-34741FYA | Mouse Anti-Rhesus A2ML1 Antibody (CBMOAB-34741FYA) |
MO-AB-03322W | Mouse Anti-Rhesus A2ML1 Antibody (MO-AB-03322W) |
For Research Use Only | Not For Clinical Use.