Mouse Anti-Rhesus AACS (clone MO34750FYA) Antibody (CBMOAB-34750FYA)


Cat: CBMOAB-34750FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34750FYA
SpecificityThis antibody binds to Rhesus AACS.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActivates acetoacetate to acetoacetyl-CoA. May be involved in utilizing ketone body for the fatty acid-synthesis during adipose tissue development (By similarity).
Product OverviewMouse Anti-Rhesus AACS (clone MO34750FYA) Antibody (CBMOAB-34750FYA) is a mouse antibody against AACS. It can be used for AACS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAACS
UniProt IDF6TYJ5
Protein RefseqThe length of the protein is 253 amino acids long.
The sequence is show below: MRKMGVKKGDRVVGYLPNSEHAVEAMLAAASIGAIWSSTSPDFGVNGVLDRFSQIQPKLIFSVEAVVYNGKEHSHMEKLQQVVKGLPDLKKVVVIPYVSSREKIDLSKIPNSVFLDDFLATGTSEQAPQLEFEQLPFSHPLFIMFSSGTTGAPKCMVHSAGGTLIQHLKEHLLHGNMTSSDILLCYTTAGWMMWNWMVSILATGAAMVLYDGSPLVPTPNVLWDLVDRIGHLGSWRLLQNQPQDWGHHHAWPE.
For Research Use Only | Not For Clinical Use.

Online Inquiry